PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00014221001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 133aa    MW: 14638.7 Da    PI: 9.5939
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00014221001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.6e-391674260
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                         ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grr++k 
  GSBRNA2T00014221001 16 PDKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRRSKP 74
                         68999***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-291573IPR003851Zinc finger, Dof-type
PfamPF027014.9E-321873IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.1742074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
AVRSPSSSDL MAEKRPDKII ACPRCKSMET KFCYFNNYNV NQPRHFCKGC QRYWTAGGAL  60
RNVPVGAGRR RSKPPGRAGG FSELLGAATG AVDQVELDAL LVEEWRAAAS HGVFRHDYPV  120
KRLRCYTDGQ SC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.125250.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0210431e-127AC021043.4 Arabidopsis thaliana chromosome I BAC F28N24 genomic sequence, complete sequence.
GenBankBT0299901e-127BT029990.1 Arabidopsis thaliana At1g29160 mRNA, complete cds.
GenBankCP0026841e-127CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595581.15e-97PREDICTED: dof zinc finger protein DOF1.5-like
RefseqXP_013709909.15e-97PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotP683501e-89DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLA0A0D3D6456e-97A0A0D3D645_BRAOL; Uncharacterized protein
STRINGscaffold_103229.12e-87(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28092669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.17e-91Dof family protein